PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_2714E3604.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 111aa    MW: 12800.4 Da    PI: 9.7578
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_2714E3604.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.23.7e-13452148
                           TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                           +g+W+ eEd+ l++ ++++G g +W + a+t+g+ R++  c+ rw++yl
  Traes_1DL_2714E3604.1  4 KGKWSREEDDFLKKHIEKYGIGrSWQALAETLGLQRCGRGCRARWLNYL 52
                           79******************999*************************7 PP

2Myb_DNA-binding33.69.2e-1159100245
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            g++T+ E+ ++ +   + G+  W+ Ia+ ++ gRt+  +k++w+
  Traes_1DL_2714E3604.1  59 GNFTQAEESIICEMYSKRGSC-WSVIAAQLP-GRTDLAVKNYWN 100
                            89*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.579156IPR017930Myb domain
SMARTSM007172.6E-8354IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-26399IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-21559IPR009057Homeodomain-like
CDDcd001671.91E-7652No hitNo description
PfamPF139213.1E-11767No hitNo description
SMARTSM007172.3E-757105IPR001005SANT/Myb domain
PROSITE profilePS5129410.90657107IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.4E-1960101IPR009057Homeodomain-like
CDDcd001673.84E-660100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MMKKGKWSRE EDDFLKKHIE KYGIGRSWQA LAETLGLQRC GRGCRARWLN YLRPGLKHGN  60
FTQAEESIIC EMYSKRGSCW SVIAAQLPGR TDLAVKNYWN GTXACQPYAQ H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-24210225123MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661280.12e-62PREDICTED: transcription factor RAX2-like
SwissprotQ9M2Y99e-41RAX3_ARATH; Transcription factor RAX3
TrEMBLW5ADH09e-79W5ADH0_WHEAT; Uncharacterized protein
STRINGMLOC_72262.21e-66(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122282638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.17e-43myb domain protein 87
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]